“By night all cats are gray” – Miguel Cervantes in Don Quixote
I’ve always liked Siamese cats. Students do, too. “Why Siamese cats wear masks” is always a favorite story in genetics class. So, when I opened my January copy of The Science Teacher, I was thrilled to see an article on Siamese cat colors and proteins AND molecular genetics (1).
In the article, the authors (Todd and Kenyon) provide some background information on the enzymatic activity of tyrosinase and compare it to the catechol oxidase that causes fruit to brown, especially apples. Tyrosinase catalyzes the first step of a biochemical pathway where tyrosine is converted to dopaquinone and then to the dark colored substance, melanin. Melanin is responsible for the brown color in the ears, paws, tail, and face of Siamese cats.
The fun part of the story is that some versions of the tyrosinase gene have a mutation that makes this enzyme less stable at warmer temperatures. In warmer areas of the cat’s body, less melanin is produced, giving the cat a lighter colored body.
I love the story of the coat coloring and I think this activity has the potential to interest students.
I also like the approach that the authors take with discussing proteins and the associated phenotypes first before getting into DNA and the central dogma. I use this same order in my bioinformatics class.
There are, however, a few things that I would change with this activity.
Too many hydroxyl groups
First, the article and the teacher guide have the structure of tyrosine wrong. Tyrosine only has one hydroxyl group attached to the six-carbon ring, as shown below, not two hydroxyl groups as shown in the article and the teachers’ guide.
Space-filling models of Tyrosine and Dopaquinone downloaded from the NCBI’s PubChem database are shown below.
Too many proteins in too short a time
Second, I think the authors include way too many different protein stories and different explanations for why a protein might be inactivated. Todd and Kenyon have done quite a bit of work creating activities with several different proteins. But I think the plan to have students cover all eight proteins in six days would be too confusing for many students. The activity has students read about or work with: lactase, cellulase, tyrosinase, catechol oxidase, proteases, kinesin, galactosyl transferase, and tyrosine kinase, not to mention Gleevec and the way it interacts with the BCR-ABL fusion protein. I teach a college bioinformatics course and even the best of my students would get confused by looking at eight different proteins without some kind of common thread. The take home lesson that denaturation negatively impacts tyrosinase activity is easy to lose among all the unrelated activities.
Where are the 3D models?
My greatest disappointment though was that the article talked about having students look at 3D models and how students could look at molecules and see how they changed when they were denatured by heat or pH. I completely misinterpreted that description. If I were teaching this class, I would rather have students work first-hand with structure models instead the authors provide a link where students can watch a video on denaturation.
This is my bias, but I think an active learning approach, where students actually look at 3D protein and chemical models and identify chemical interactions, would be better in long run and better equip students for future learning. I think the common practice of hiding the biochemistry makes genetics much harder to understand and far less straightforward than it should be.
And, as it turns out there are 3D models of tyrosinase that students could use. They’re from Bacillus megatherium, but that’s how biology works. If an enzyme activity is beneficial, evolutionary processes tend to keep it around.
Using 3D Models to look at albino cats
No models exist from the Siamese cat protein with the brown ear point mutation, but it is possible to make 3D protein models that show the affect of a different mutation, in tyrosinase, that leads to albino cats. This mutation occurs when a cytosine is deleted at nucleotide 975, creating a frameshift (2). To simulate the mutation’s effect, we can hide the amino acids that would be lost. This model isn’t perfect because the shorter protein might fold somewhat differently, but this does provide a satisfying explanation for an inactive enzyme.
Here’s what to do:
- Open Molecule World on the iPad (*).
- Download 4P6R.
- Color the protein chains by molecule.
- Open the sequence viewer and touch the name of the last row to select it. This row contains tyrosine, the substrate for the enzyme, and for each chain, two atoms of zinc.
- Change the coloring style to element.
Now, you can see the substrate bound in the active site. Notice this protein has two identical subunits. Each one is bound to tyrosine and zinc.
You may want to change the atom visibility to show all the atoms or just the core backbone, like I have here, to see how the tyrosine is positioned.
*Many of the things I describe here can be done in Cn3D, but it’s a bit more complicated.
Modeling the mutation’s affect
This next part is a little more complicated because I had to split the protein sequence into three parts to avoid introducing spaces.
- Carry out the following process in three steps. First, copy the sequence below.KYRVRKNVLHLTDTEKRDFVRTVLIKEKGIYDRYIAWHGAAGKFHTPPGSDRNA
- Touch the Selection button and paste the sequence below in the Select pattern window.
- Start the search. The pasted sequence will be highlighted in the protein sequence.
- Copy the next part of the sequence (below). Touch the Selection button again and search for this pattern as before.
AHMSSAFLPWHREYLLRFERDQSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGN - Copy the next part of the sequence (below). Touch the Selection button again and search for this pattern as before.
GNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKAPTLPTRDDVL
- When you’re done highlighting sequences, you’ll see each subunit has a region that appears brighter and a region in the center that appears more dim. The bright colored residues are incorporated into the protein before ribosomes encounter the frame shift mutation and a stop codon shortly afterwards. This portion of the protein can be produced in the albino cat.
- Look at the dim areas of each subunit. These amino acids would be lost when the frameshift mutation is present. Notice where the tyrosine is located.
8. To make the mutations affect on the protein even more clear, open the Show/Hide button and choose “Hide unselected.” The amino acid residues that would be lost because of the mutation disappear.
Now, it’s really clear. If the residues that bind tyrosine and modify it’s structure are gone, the enzyme is unable to function. If we don’t have tyrosinase working to help make melanin, we get white cats.
References:
- Amber Todd and Lisa Kenyon, How do Siamese cats get their color? The Science Teacher. 2016;83(1):29-36
- Imes D, Geary L, Grahn R, Lyons L. Albinism in the domestic cat (Felis catus) is associated with a tyrosinase (TYR) mutation. Animal Genetics. 2006;37(2):175-178. doi:10.1111/j.1365-2052.2005.01409.x.
from ScienceBlogs http://ift.tt/1mr5yCU
“By night all cats are gray” – Miguel Cervantes in Don Quixote
I’ve always liked Siamese cats. Students do, too. “Why Siamese cats wear masks” is always a favorite story in genetics class. So, when I opened my January copy of The Science Teacher, I was thrilled to see an article on Siamese cat colors and proteins AND molecular genetics (1).
In the article, the authors (Todd and Kenyon) provide some background information on the enzymatic activity of tyrosinase and compare it to the catechol oxidase that causes fruit to brown, especially apples. Tyrosinase catalyzes the first step of a biochemical pathway where tyrosine is converted to dopaquinone and then to the dark colored substance, melanin. Melanin is responsible for the brown color in the ears, paws, tail, and face of Siamese cats.
The fun part of the story is that some versions of the tyrosinase gene have a mutation that makes this enzyme less stable at warmer temperatures. In warmer areas of the cat’s body, less melanin is produced, giving the cat a lighter colored body.
I love the story of the coat coloring and I think this activity has the potential to interest students.
I also like the approach that the authors take with discussing proteins and the associated phenotypes first before getting into DNA and the central dogma. I use this same order in my bioinformatics class.
There are, however, a few things that I would change with this activity.
Too many hydroxyl groups
First, the article and the teacher guide have the structure of tyrosine wrong. Tyrosine only has one hydroxyl group attached to the six-carbon ring, as shown below, not two hydroxyl groups as shown in the article and the teachers’ guide.
Space-filling models of Tyrosine and Dopaquinone downloaded from the NCBI’s PubChem database are shown below.
Too many proteins in too short a time
Second, I think the authors include way too many different protein stories and different explanations for why a protein might be inactivated. Todd and Kenyon have done quite a bit of work creating activities with several different proteins. But I think the plan to have students cover all eight proteins in six days would be too confusing for many students. The activity has students read about or work with: lactase, cellulase, tyrosinase, catechol oxidase, proteases, kinesin, galactosyl transferase, and tyrosine kinase, not to mention Gleevec and the way it interacts with the BCR-ABL fusion protein. I teach a college bioinformatics course and even the best of my students would get confused by looking at eight different proteins without some kind of common thread. The take home lesson that denaturation negatively impacts tyrosinase activity is easy to lose among all the unrelated activities.
Where are the 3D models?
My greatest disappointment though was that the article talked about having students look at 3D models and how students could look at molecules and see how they changed when they were denatured by heat or pH. I completely misinterpreted that description. If I were teaching this class, I would rather have students work first-hand with structure models instead the authors provide a link where students can watch a video on denaturation.
This is my bias, but I think an active learning approach, where students actually look at 3D protein and chemical models and identify chemical interactions, would be better in long run and better equip students for future learning. I think the common practice of hiding the biochemistry makes genetics much harder to understand and far less straightforward than it should be.
And, as it turns out there are 3D models of tyrosinase that students could use. They’re from Bacillus megatherium, but that’s how biology works. If an enzyme activity is beneficial, evolutionary processes tend to keep it around.
Using 3D Models to look at albino cats
No models exist from the Siamese cat protein with the brown ear point mutation, but it is possible to make 3D protein models that show the affect of a different mutation, in tyrosinase, that leads to albino cats. This mutation occurs when a cytosine is deleted at nucleotide 975, creating a frameshift (2). To simulate the mutation’s effect, we can hide the amino acids that would be lost. This model isn’t perfect because the shorter protein might fold somewhat differently, but this does provide a satisfying explanation for an inactive enzyme.
Here’s what to do:
- Open Molecule World on the iPad (*).
- Download 4P6R.
- Color the protein chains by molecule.
- Open the sequence viewer and touch the name of the last row to select it. This row contains tyrosine, the substrate for the enzyme, and for each chain, two atoms of zinc.
- Change the coloring style to element.
Now, you can see the substrate bound in the active site. Notice this protein has two identical subunits. Each one is bound to tyrosine and zinc.
You may want to change the atom visibility to show all the atoms or just the core backbone, like I have here, to see how the tyrosine is positioned.
*Many of the things I describe here can be done in Cn3D, but it’s a bit more complicated.
Modeling the mutation’s affect
This next part is a little more complicated because I had to split the protein sequence into three parts to avoid introducing spaces.
- Carry out the following process in three steps. First, copy the sequence below.KYRVRKNVLHLTDTEKRDFVRTVLIKEKGIYDRYIAWHGAAGKFHTPPGSDRNA
- Touch the Selection button and paste the sequence below in the Select pattern window.
- Start the search. The pasted sequence will be highlighted in the protein sequence.
- Copy the next part of the sequence (below). Touch the Selection button again and search for this pattern as before.
AHMSSAFLPWHREYLLRFERDQSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGN - Copy the next part of the sequence (below). Touch the Selection button again and search for this pattern as before.
GNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKAPTLPTRDDVL
- When you’re done highlighting sequences, you’ll see each subunit has a region that appears brighter and a region in the center that appears more dim. The bright colored residues are incorporated into the protein before ribosomes encounter the frame shift mutation and a stop codon shortly afterwards. This portion of the protein can be produced in the albino cat.
- Look at the dim areas of each subunit. These amino acids would be lost when the frameshift mutation is present. Notice where the tyrosine is located.
8. To make the mutations affect on the protein even more clear, open the Show/Hide button and choose “Hide unselected.” The amino acid residues that would be lost because of the mutation disappear.
Now, it’s really clear. If the residues that bind tyrosine and modify it’s structure are gone, the enzyme is unable to function. If we don’t have tyrosinase working to help make melanin, we get white cats.
References:
- Amber Todd and Lisa Kenyon, How do Siamese cats get their color? The Science Teacher. 2016;83(1):29-36
- Imes D, Geary L, Grahn R, Lyons L. Albinism in the domestic cat (Felis catus) is associated with a tyrosinase (TYR) mutation. Animal Genetics. 2006;37(2):175-178. doi:10.1111/j.1365-2052.2005.01409.x.
from ScienceBlogs http://ift.tt/1mr5yCU
Aucun commentaire:
Enregistrer un commentaire